PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 269aa    MW: 30289.1 Da    PI: 7.1823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877741.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.41.8e-41121111100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lr+kC+++Cv+apyfp +qp+kfanvh+++Gasnv kll++l++ +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l 
  XP_015877741.1  12 PCAACKFLRQKCTQECVFAPYFPPDQPQKFANVHRVYGASNVGKLLNKLNTVHREDAVTSLAYEAEARLRDPVYGCVGFISILQNRLRQVQSDLY 106
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++k+e
  XP_015877741.1 107 AAKKE 111
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.46311112IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4012109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSSSSSSSSH SPCAACKFLR QKCTQECVFA PYFPPDQPQK FANVHRVYGA SNVGKLLNKL  60
NTVHREDAVT SLAYEAEARL RDPVYGCVGF ISILQNRLRQ VQSDLYAAKK ELAAYIGPQA  120
MMIQPQHQPQ HAAAADYNIN MPTPMPMAAP MPMLGIPTGL SQGGGDLVIR EPQQQQHQQQ  180
MYEVHQEQEV VRFDHDQMMM NISMSPSLGL GSTFDQNAYH IQQHPQQPPA AHYHHLHHPT  240
DQYQQLQPQV LLHQPQQAQH YHHKSSEQG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877741.10.0PREDICTED: LOB domain-containing protein 6-like
SwissprotQ9FKZ35e-64LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A067DDH13e-79A0A067DDH1_CITSI; Uncharacterized protein
TrEMBLV4UIA83e-79V4UIA8_9R
STRINGPOPTR_0007s11460.14e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-57ASYMMETRIC LEAVES 2-like 1